LEMD2 Antibody - middle region : FITC

LEMD2 Antibody - middle region : FITC
Artikelnummer
AVIARP55792_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LEMD2 is involved in nuclear structure organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2

Key Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: SRRRMKRVWDRAVEFLASNESRIQTESHRVAGEDMLVWRWTKPSSFSDSE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LEM domain-containing protein 2

Protein Size: 503

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55792_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55792_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 221496
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×