LEMD2 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: LEMD2 is involved in nuclear structure organization.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LEMD2

Key Reference: Otsuki,T., (2005) DNA Res. 12 (2), 117-126

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LEM domain-containing protein 2

Protein Size: 503

Purification: Affinity Purified

• Artikelnummer: AVIARP55791_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55791_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 221496
• Wirt: Rabbit