LGALS3BP Antibody - middle region : Biotin

LGALS3BP Antibody - middle region : Biotin
Artikelnummer
AVIARP54779_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LGALS3BP

Key Reference: Lee,Y.J., Clin. Exp. Rheumatol. 25 (4 SUPPL 45), S41-S45 (2007)

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: galectin-3-binding protein

Protein Size: 585

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54779_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54779_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3959
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×