LIF Antibody - N-terminal region : FITC

LIF Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54690_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface.Leukaemia inhibitory factor is a cytokine that induces macrophage differentiation. Neurotransmitters and neuropeptides, well known for their role in the communication between neurons, are also capable of activating monocytes and macrophages and inducing chemotaxis in immune cells. LIF signals through different receptors and transcription factors. LIF in conjunction with BMP2 acts in synergy on primary fetal neural progenitor cells to induce astrocytes. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LIF

Key Reference: Robertson,M.W., (2008) Cancer Invest. 26 (3), 222-229

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Leukemia inhibitory factor

Protein Size: 202

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54690_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54690_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3976
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×