Lig3 Antibody - C-terminal region : HRP

Lig3 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54960_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Molecular Weight: 111kDa

Peptide Sequence: Synthetic peptide located within the following region: TPCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSAT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA ligase RuleBase RU000617

Protein Size: 1012

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54960_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54960_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 16882
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×