LIN37 Antibody - middle region : Biotin

LIN37 Antibody - middle region : Biotin
Artikelnummer
AVIARP57335_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a protein expressed in the eye.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LIN37

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein lin-37 homolog

Protein Size: 246

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57335_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57335_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55957
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×