LIPT1 antibody

Calculated MW: 42

Form: Liquid

Buffer (with preservative): PBS, 2% sucrose, 0.09% sodium azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Background: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, the protein encoded by this gene transfers the lipoyl moiety to apoproteins. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 13. Read-through transcription also exists between this gene and the neighboring downstream mitochondrial ribosomal protein L30 (MRPL30) gene. [provided by RefSeq, Mar 2011]

Uniprot ID: Q9Y234

Antigen Species: Human

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human LIPT protein: RALNAVQPQLDVQATKRFDLLLDGQFKISGTASKIGRTTAYHHCTLLCST

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: lipoyltransferase 1

• Artikelnummer: GTX04597-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04597-100
• Green Labware: Nein
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 51601
• Wirt: Rabbit