LRP1 Antibody - middle region : Biotin

LRP1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58562_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Low-density lipoprotein receptor-related protein 1 (.-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LRP1

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolow-density lipoprotein receptor-related protein 1

Protein Size: 439

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58562_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58562_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 4035
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×