English
LRRC33 Antibody - N-terminal region : Biotin
LRRC33 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55907_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: The specific function of the protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC33
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Leucine-rich repeat-containing protein 33
Protein Size: 692
Purification: Affinity Purified
Description of Target: The specific function of the protein remains unknown.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC33
Key Reference: Clark,H.F., (2003) Genome Res. 13 (10), 2265-2270
Molecular Weight: 76kDa
Peptide Sequence: Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Leucine-rich repeat-containing protein 33
Protein Size: 692
Purification: Affinity Purified
| Artikelnummer | AVIARP55907_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55907_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 375387 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
