LTB4DH Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: LTB4DH functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. It has no activity towards PGE1, PGE2 and PGE2-alpha. LTB4DH catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12-oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LTB4DH

Key Reference: Chou,W.L., (2007) J. Biol. Chem. 282 (25), 18162-18172

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: VRTKTWTLKKHFVGYPTNSDFELKTSELPPLKNGEVLLEALFLTVDPYMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prostaglandin reductase 1

Protein Size: 329

Purification: Affinity Purified

• Artikelnummer: AVIARP54865_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54865_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 22949
• Wirt: Rabbit