English
Lynx1 Antibody - middle region : HRP
Lynx1 Antibody - middle region : HRP
Artikelnummer
AVIARP58708_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: Lynx1 seems to modulate nicotinic acetylcholine receptors. It promotes the largest of three current amplitudes elicited by ACh through alpha4beta2 nAChRs and that LYNX1 enhances desensitization.
Molecular Weight: 13kDa
Peptide Sequence: Synthetic peptide located within the following region: PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ly-6/neurotoxin-like protein 1
Protein Size: 116
Purification: Affinity Purified
Description of Target: Lynx1 seems to modulate nicotinic acetylcholine receptors. It promotes the largest of three current amplitudes elicited by ACh through alpha4beta2 nAChRs and that LYNX1 enhances desensitization.
Molecular Weight: 13kDa
Peptide Sequence: Synthetic peptide located within the following region: PAMATYCMTTRTYFTPYRMKVRKSCVPSCFETVYDGYSKHASATSCCQYY
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Ly-6/neurotoxin-like protein 1
Protein Size: 116
Purification: Affinity Purified
| Artikelnummer | AVIARP58708_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58708_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 23936 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
