LYPD5 Antibody - N-terminal region : Biotin

LYPD5 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55826_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPD5

Key Reference: Zhang,Z. (2004) Protein Sci. 13 (10), 2819-2824

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: WTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ly6/PLAUR domain-containing protein 5

Protein Size: 208

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55826_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55826_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284348
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×