LYPLA2 Antibody - N-terminal region : Biotin

LYPLA2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58638_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids.Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. There are alternatively spliced transcript variants described for this gene but the full length nature is not known yet.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LYPLA2

Key Reference: Ma,J., (2007) Atherosclerosis 191 (1), 63-72

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acyl-protein thioesterase 2

Protein Size: 231

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58638_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58638_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 11313
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×