Lyrm4 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Lyrm4 is required for nuclear and mitochondrial iron-sulfur protein biosynthesis.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: VRRIRDAFRENKNVKDPVEIQALVNKAKRDLEIIRRQVHIGQLYSTDKLI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: LYR motif-containing protein 4

Protein Size: 91

Purification: Affinity Purified

• Artikelnummer: AVIARP57407_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57407_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 380840
• Wirt: Rabbit