English
Lysozyme antibody
Lysozyme antibody
Artikelnummer
GTX03467-100
Verpackungseinheit
100 μg
Hersteller
GeneTex
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. ICC/IF: 5μg/ml. IHC-P: 0.5-1μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 17
Form: Liquid
Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]
Uniprot ID: P61626
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa; NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: lysozyme
Calculated MW: 17
Form: Liquid
Buffer (with preservative): 5mg BSA, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the antimicrobial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. The protein has antibacterial activity against a number of bacterial species. Missense mutations in this gene have been identified in heritable renal amyloidosis. [provided by RefSeq, Oct 2014]
Uniprot ID: P61626
Antigen Species: Human
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Lysozyme (106-141aa; NIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQ).
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: lysozyme
| Artikelnummer | GTX03467-100 |
|---|---|
| Hersteller | GeneTex |
| Hersteller Artikelnummer | GTX03467-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 μg |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Immunofluorescence, Immunohistochemistry (paraffin), Western Blotting, Immunocytochemistry |
| Isotyp | IgG |
| Human Gene ID | 4069 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
