English
MAB21L1 Antibody - N-terminal region : HRP
MAB21L1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54782_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1
Key Reference: Smith,M., (2002) Cytogenet. Genome Res. 98 (4), 233-239
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein mab-21-like 1
Protein Size: 359
Purification: Affinity Purified
Description of Target: This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders.This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Sequence Note: The sequence U38810.1 is a chimeric mRNA clone. Only the mab-21-like protein 1 region was propagated into this RefSeq record.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAB21L1
Key Reference: Smith,M., (2002) Cytogenet. Genome Res. 98 (4), 233-239
Molecular Weight: 41kDa
Peptide Sequence: Synthetic peptide located within the following region: IAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPR
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Protein mab-21-like 1
Protein Size: 359
Purification: Affinity Purified
| Artikelnummer | AVIARP54782_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP54782_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 4081 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
