MAFB Antibody - C-terminal region : FITC

MAFB Antibody - C-terminal region : FITC
Artikelnummer
AVIARP58149_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MAFB

Key Reference: Gemelli,C., (2006) Cell Death Differ. 13 (10), 1686-1696

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: LIQQVEQLKQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcription factor MafB

Protein Size: 323

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58149_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58149_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9935
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×