MAGEB3 Antibody - N-terminal region : FITC

MAGEB3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56339_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognized on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB3

Key Reference: Ross,M.T., (2005) Nature 434 (7031), 325-337

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: KKKVSFSSPLILGATIQKKSAGRSRSALKKPQRALSTTTSVDVSYKKSYK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen B3

Protein Size: 346

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56339_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56339_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4114
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×