Magee1 Antibody - C-terminal region : FITC

Magee1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57492_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: GRECTKVFPDLLNRAARTLNHVYGTELVVLDPRNHSYTLYNRREMEDTEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Melanoma-associated antigen E1

Protein Size: 724

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57492_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57492_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 107528
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×