English
MAN2B2 Antibody : Biotin
MAN2B2 Antibody : Biotin
Artikelnummer
AVIARP55216_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG
Molecular Weight: 114 kDa
Peptide Sequence: Synthetic peptide located within the following region: QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Epididymis-specific alpha-mannosidase
Protein Size: 1009
Purification: Affinity Purified
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG
Molecular Weight: 114 kDa
Peptide Sequence: Synthetic peptide located within the following region: QEARGLQFVWRGSPSLSERQEIFTHIMDQYSYCTPSHIPFSNRSGFYWNG
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Epididymis-specific alpha-mannosidase
Protein Size: 1009
Purification: Affinity Purified
| Artikelnummer | AVIARP55216_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP55216_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Zebrafish |
| Klonalität | Polyclonal |
| Human Gene ID | 23324 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
