English
MAOA Antibody - middle region : HRP
MAOA Antibody - middle region : HRP
Artikelnummer
AVIARP56075_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAOA
Key Reference: Shiels,M.S., (2008) Prev Med 47 (1), 116-122
Molecular Weight: 60kDa
Peptide Sequence: Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Amine oxidase [flavin-containing] A
Protein Size: 527
Purification: Affinity Purified
Description of Target: MAOA catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine.This gene encodes monoamine oxidase A, an enzyme that degrades amine neurotransmitters, such as dopamine, norepinephrine, and serotonin. The protein localizes to the mitochondrial outer membrane. The gene is adjacent to a related gene on the opposite strand of chromosome X. Mutation in this gene results in monoamine oxidase deficiency, or Brunner syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAOA
Key Reference: Shiels,M.S., (2008) Prev Med 47 (1), 116-122
Molecular Weight: 60kDa
Peptide Sequence: Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Amine oxidase [flavin-containing] A
Protein Size: 527
Purification: Affinity Purified
| Artikelnummer | AVIARP56075_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56075_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 4128 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
