MAP7D1 Antibody - N-terminal region : HRP

MAP7D1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57105_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAP7D1

Key Reference: Kleiderlein,J.J., (1998) Hum. Genet. 103 (6), 666-673

Molecular Weight: 93kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRLEEQRLKAEQRRAALEERQRQKLEKNKERYEAAIQRSVKKTWAEIRQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: MAP7 domain-containing protein 1

Protein Size: 841

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57105_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57105_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55700
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×