Mapk10 Antibody - N-terminal region : FITC

Mapk10 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP57728_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mapk10 is a stress-activated protein kinase.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: JNK3 protein EMBL ABD24063.1

Protein Size: 426

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57728_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57728_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25272
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×