Mapk10 Antibody - N-terminal region : HRP

Mapk10 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP57728_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Mapk10 is a stress-activated protein kinase.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: JNK3 protein EMBL ABD24063.1

Protein Size: 426

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57728_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57728_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25272
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×