MAPK12 Antibody - N-terminal region : Biotin

MAPK12 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56535_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Activation of members of the mitogen-activated protein kinase family is a major mechanism for transduction of extracellular signals. Stress-activated protein kinases are one subclass of MAP kinases. The protein encoded by this gene functions as a signal t

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAPK12

Key Reference: Qi,X., (2007) J. Biol. Chem. 282 (43), 31398-31408

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: SGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 12

Protein Size: 367

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56535_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56535_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6300
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×