MAPK13 Antibody - middle region : Biotin

MAPK13 Antibody - middle region : Biotin
Artikelnummer
AVIARP56439_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and cellular stress. MAP kinase kinases 3, and 6 can phosphorylate and activate this kinase. Transcription factor ATF2, and microtubule dynamics regulator stathmin have been shown to be the substrates of this kinase.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: EMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitogen-activated protein kinase 13

Protein Size: 365

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56439_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56439_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5603
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×