MARK3 Antibody - middle region : Biotin

MARK3 Antibody - middle region : Biotin
Artikelnummer
AVIARP56343_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MARK3

Key Reference: Murphy,J.M., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (36), 14336-14341

Molecular Weight: 81kDa

Peptide Sequence: Synthetic peptide located within the following region: ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MAP/microtubule affinity-regulating kinase 3

Protein Size: 729

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56343_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56343_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4140
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×