MATN3 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of von Willebrand factor A domain containing protein family. This family of proteins is thought to be involved in the formation of filamentous networks in the extracellular matrices of various tissues. This protein contains two

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN3

Key Reference: Fresquet,M., Hum. Mutat. 29 (2), 330 (2008)

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Matrilin-3

Protein Size: 486

Purification: Affinity Purified

• Artikelnummer: AVIARP56345_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56345_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 4148
• Wirt: Rabbit