MED16 Antibody - C-terminal region : FITC

MED16 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP57927_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16

Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 16

Protein Size: 877

Purification: Affinity Purified

Subunit: 16
Mehr Informationen
Artikelnummer AVIARP57927_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57927_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10025
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×