English
MED16 Antibody - C-terminal region : HRP
MED16 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57927_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16
Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691
Molecular Weight: 97kDa
Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Mediator of RNA polymerase II transcription subunit 16
Protein Size: 877
Purification: Affinity Purified
Subunit: 16
Description of Target: THRAP5 is part of the human thyroid hormone receptor-associated protein (TRAP)-Mediator family which acts as a coactivator for a broad range of nuclear hormone receptors as well as other classes of transcriptional activators.
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MED16
Key Reference: Sato,S., (2004) Mol. Cell 14 (5), 685-691
Molecular Weight: 97kDa
Peptide Sequence: Synthetic peptide located within the following region: MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPAS
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Mediator of RNA polymerase II transcription subunit 16
Protein Size: 877
Purification: Affinity Purified
Subunit: 16
| Artikelnummer | AVIARP57927_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP57927_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10025 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
