Med19 Antibody - N-terminal region : Biotin

Med19 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55595_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: MRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription, subunit 19 homolog (Yeast) (Predicted) EMBL EDL79310.1

Protein Size: 244

Purification: Affinity Purified

Subunit: 19
Mehr Informationen
Artikelnummer AVIARP55595_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55595_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 311165
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×