Med31 Antibody - C-terminal region : HRP

Med31 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP56821_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Med31

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: YEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNTTAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Mediator of RNA polymerase II transcription, subunit 31 homolog (Yeast) (Predicted) EMBL EDM05096.1

Protein Size: 131

Purification: Affinity Purified

Subunit: 31
Mehr Informationen
Artikelnummer AVIARP56821_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56821_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 287475
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×