English
MED31 Antibody - N-terminal region : HRP
MED31 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56820_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31
Key Reference: Cavdar (er) World J Surg (2008) In press
Molecular Weight: 16kDa
Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Mediator of RNA polymerase II transcription subunit 31
Protein Size: 131
Purification: Affinity Purified
Subunit: 31
Description of Target: MED31 is the component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MED31
Key Reference: Cavdar (er) World J Surg (2008) In press
Molecular Weight: 16kDa
Peptide Sequence: Synthetic peptide located within the following region: MAAAVAMETDDAGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVN
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Mediator of RNA polymerase II transcription subunit 31
Protein Size: 131
Purification: Affinity Purified
Subunit: 31
| Artikelnummer | AVIARP56820_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56820_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting, Chromatin Immunoprecipitation (ChIP) |
| Human Gene ID | 51003 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
