MED7 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED7

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: KRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 7

Protein Size: 233

Purification: Affinity Purified

Subunit: 7

• Artikelnummer: AVIARP57925_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57925_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting, Chromatin Immunoprecipitation (ChIP)
• Human Gene ID: 9443
• Wirt: Rabbit