MEIOC Antibody - C-terminal region : Biotin

Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: meiosis-specific coiled-coil domain-containing protein MEIOC

Protein Size: 622

Purification: Affinity Purified

• Artikelnummer: AVIARP54485_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54485_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 284071
• Wirt: Rabbit