MEIOC Antibody - C-terminal region : HRP

MEIOC Antibody - C-terminal region : HRP
Artikelnummer
AVIARP54485_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FLJ35848

Molecular Weight: 71kDa

Peptide Sequence: Synthetic peptide located within the following region: LHIRLEECCEQWRALEKERKKTELALAKNYPGKKVSSTNNTPVPRLTSNP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: meiosis-specific coiled-coil domain-containing protein MEIOC

Protein Size: 622

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54485_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54485_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284071
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×