MEMO1 Antibody - middle region : Biotin

MEMO1 Antibody - middle region : Biotin
Artikelnummer
AVIARP56786_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MEMO1

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein MEMO1

Protein Size: 297

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56786_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56786_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51072
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×