English
MERTK Antibody - N-terminal region : Biotin
MERTK Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP59019_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK
Key Reference: N/A
Molecular Weight: 109kDa
Peptide Sequence: Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tyrosine-protein kinase Mer
Protein Size: 999
Purification: Affinity purified
Description of Target: This gene is a member of the MER/AXL/TYRO3 receptor kinase family and encodes a transmembrane protein with two fibronectin type-III domains, two Ig-like C2-type (immunoglobulin-like) domains, and one tyrosine kinase domain. Mutations in this gene have been associated with disruption of the retinal pigment epithelium (RPE) phagocytosis pathway and onset of autosomal recessive retinitis pigmentosa (RP).
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MERTK
Key Reference: N/A
Molecular Weight: 109kDa
Peptide Sequence: Synthetic peptide located within the following region: PEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVS
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Tyrosine-protein kinase Mer
Protein Size: 999
Purification: Affinity purified
| Artikelnummer | AVIARP59019_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP59019_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 10461 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
