METTL5 Antibody - N-terminal region : HRP

METTL5 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP54982_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: METTL5 is a probable methyltransferase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human METTL5

Key Reference: Hillier,L.W., (2005) Nature 434 (7034), 724-731

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: IAACMLYTIHNTYDDIENKVVADLGCGCGVLSIGTAMLGAGLCVGFDIDE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Methyltransferase-like protein 5

Protein Size: 209

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54982_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54982_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 29081
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×