MGC34821 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The specific function of this protein remains unknown

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MGC34821

Molecular Weight: 61kDa

Peptide Sequence: Synthetic peptide located within the following region: VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Solute carrier family 22 member 24 Ensembl ENSP00000396586

Protein Size: 551

Purification: Affinity Purified

• Artikelnummer: AVIARP56052_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56052_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 283238
• Wirt: Rabbit