MGC51025 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MGC51025 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MGC51025

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: LLCLPEEDAFWALTQLLAGERHSLWYSTAQILPGSRGSYRTRSRCCTSPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 26

Protein Size: 250

Purification: Affinity Purified

• Artikelnummer: AVIARP55784_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP55784_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 353149
• Wirt: Rabbit