MID2 Antibody - C-terminal region : Biotin

MID2 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57854_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to microtubular structures in the cytoplasm. Alternate splicing of this gene results in two transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MID2

Molecular Weight: 80kDa

Peptide Sequence: Synthetic peptide located within the following region: WGLWPEIRKCKEAVSCSRLAGAPRGLYNSVDSWMIVPNIKQNHYTVHGLQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable E3 ubiquitin-protein ligase MID2

Protein Size: 735

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57854_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57854_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 11043
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×