MIER2 Antibody - middle region : FITC

MIER2 Antibody - middle region : FITC
Artikelnummer
AVIARP56974_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: MIER2 is a transcriptional repressor.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MIER2

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: ETVAPAQVALSVTEFGLIGIGDVNPFLAAHPTCPAPGLHSEPLSHCNVMT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mesoderm induction early response protein 2

Protein Size: 545

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56974_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56974_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54531
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×