MLH1 Antibody - N-terminal region : FITC

MLH1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56076_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC.This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. Alternatively spliced transcript variants encoding different isoforms have been described, but their full-length natures have not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MLH1

Key Reference: Harley,I., (2008) Gynecol. Oncol. 109 (3), 384-387

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: MIENCLDAKSTSIQVIVKEGGLKLIQIQDNGTGIRKEDLDIVCERFTTSK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA mismatch repair protein Mlh1

Protein Size: 756

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56076_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56076_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4292
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×