English
MMP8 antibody
MMP8 antibody
Artikelnummer
GTX03673-100
Verpackungseinheit
100 μg
Hersteller
GeneTex
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Application Note: WB: 0.1-0.5μg/ml. IHC-P: 0.5-1μg/m. ELISA: 0.1-0.5μg/ml. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.
Calculated MW: 53
Form: Liquid
Buffer (with preservative): 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 5mg BSA, 0.05mg sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades types I, II and III collagens. Mice lacking the encoded protein exhibit abnormalities in the inflammatory responses to various agents. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. [provided by RefSeq, Feb 2016]
Uniprot ID: O70138
Antigen Species: Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: matrix metallopeptidase 8
Calculated MW: 53
Form: Liquid
Buffer (with preservative): 0.9 mg NaCl, 0.2 mg Na₂HPO₄, 5mg BSA, 0.05mg sodium azide.
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Background: This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme that degrades types I, II and III collagens. Mice lacking the encoded protein exhibit abnormalities in the inflammatory responses to various agents. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. [provided by RefSeq, Feb 2016]
Uniprot ID: O70138
Antigen Species: Mouse
Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD), different from the related human sequence by eleven amino acids, and from the related rat sequence by nine amino acids.
Purification: Purified by antigen-affinity chromatography
Conjugation: Unconjugated
Full Name: matrix metallopeptidase 8
| Artikelnummer | GTX03673-100 |
|---|---|
| Hersteller | GeneTex |
| Hersteller Artikelnummer | GTX03673-100 |
| Green Labware | Nein |
| Verpackungseinheit | 100 μg |
| Mengeneinheit | STK |
| Reaktivität | Mouse (Murine), Rat (Rattus) |
| Klonalität | Polyclonal |
| Methode | Immunohistochemistry (paraffin), Western Blotting, ELISA |
| Isotyp | IgG |
| Human Gene ID | 17394 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
Laurent Haze
