MPEG1 Antibody - C-terminal region : FITC

MPEG1 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP54495_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human MPEG1

Key Reference: Spilsbury,K., (1995) Blood 85 (6), 1620-1629

Molecular Weight: 78kDa

Peptide Sequence: Synthetic peptide located within the following region: TILAVVITLAIYGTRKFKKKAYQAIEERQSLVPGTAATGDTTYQEQGQSP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Macrophage-expressed gene 1 protein

Protein Size: 716

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54495_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54495_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 219972
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×