MRPL48 Antibody - middle region : Biotin

MRPL48 Antibody - middle region : Biotin
Artikelnummer
AVIARP56816_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPL48

Key Reference: Zhang,Z. (2003) Genomics 81 (5), 468-480

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 39S ribosomal protein L48, mitochondrial

Protein Size: 212

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56816_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56816_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51642
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×