MRPL50 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a putative 39S subunit protein and belongs to the L47P ribosomal protein family. Pseudogenes corresponding to this gene are found on chromosomes 2p, 2q, 5p, and 10q.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RM50

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: CREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 39S ribosomal protein L50, mitochondrial

Protein Size: 158

Purification: Affinity Purified

• Artikelnummer: AVIARP57317_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57317_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54534
• Wirt: Rabbit