MRPL58 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a peptidyl-tRNA hydrolase and a vital component of the large mitochondrial ribosome. The encoded protein serves as a ribosome release factor for this ribosome, which translates mitochondrial genes. This protein may be responsible for degrading prematurely-terminated polypeptides and for reusing stalled ribosomes. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ICT1

Key Reference: van (1995) Eur. J. Biochem. 234 (3), 843-848

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: AEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: peptidyl-tRNA hydrolase ICT1, mitochondrial

Protein Size: 206

Purification: Affinity Purified

• Artikelnummer: AVIARP54583_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP54583_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3396
• Wirt: Rabbit