MRPS2 Antibody - middle region : FITC

MRPS2 Antibody - middle region : FITC
Artikelnummer
AVIARP56813_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S2 family.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MRPS2

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: VHLYCRLFQTAITRAKEKRQQVEALYRLQGQKEPGDQGPAHPPGADMSHS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 28S ribosomal protein S2, mitochondrial

Protein Size: 296

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56813_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56813_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51116
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×